Pay in 4 interest-free payments of $27.18 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
AA Sequence: HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC
Biodegradable and non toxic
AF7622-100
RRID: AB_2847233
Catalogue Number: DF14151
Recombinant IL-18BP, Human - BK0236 PolyMag AA Sequence: HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLCRecombinant IL 18BP, Human Catalogue Numbers: BK0236 10, BK0236 50 Sizes: 10g, 50g Source: CHO Molecular Weight: 42 44 kDa, observed by reducing SDS PAGE. Purity: > 95% as analyzed by SDS PAGE and HPLC. Biological Activity: ED50 < 30 ng ml, measured in a bioassay using KG 1 cells in the presence of 50ng ml Human IL 18. Physical Appearance: Sterile Filtered White lyophilized (freeze dried) powder. Formulation: Lyophilized after extensive dialysis
US$ 12.00
US$ 12.00
US$ 12.00
US$ 12.00
US$ 12.00
US$ 12.00
US$ 12.00
US$ 12.00
US$ 12.00
US$ 12.00
US$ 12.00